How to Reconstitute IGF-1 LR3
Research Stock Preparation Calculator

IGF-1 LR3 is supplied as a 1mg/vial vial for research use only. Its molecular weight is 9117.50 g/mol (C400H625N111O115S9). Primary sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY CAPLKPAKSA. The steps below cover reconstitution and stock-concentration calculation for laboratory aliquoting. This page is not dosing guidance; the compound is not for human or veterinary use.

Reconstitution calculator

Enter the amount of compound in the vial and the solvent volume you plan to add to obtain the working concentration for research aliquoting.

Research stock-preparation calculator — for laboratory aliquoting and concentration only. Not dosing guidance; all compounds are for research use only, not for human or veterinary use.
Advanced: Net Peptide Content (NPC)

Peptide content factor accounts for counter-ions (TFA/acetate) and bound water. If unknown, an amino-acid analysis (AAA) on the certificate gives the real figure; TFA salts of small peptides commonly sit near 70–85%.

Reconstitution guide

Reconstitueren met 0,1M azijnzuur.

Oplosbaarheid

Oplosbaar in 0,1M azijnzuur bij 0,1mg/mL

Storage & stability

Bewaren bij -20°C, beschermen tegen licht

Shelf life: 24 maanden vanaf productiedatum.

Appearance & purity

Appearance: Wit gelyofiliseerd poeder.

Purity: ≥99% (HPLC).

Referentiegegevens

Presentatie
1mg/vial
CAS-nummer
946870-92-4
Moleculaire formule
C400H625N111O115S9
Molecuulgewicht
9117.50
Zuiverheid
≥99% (HPLC)
Opslag
Bewaren bij -20°C, beschermen tegen licht

Research Use Only. This information supports laboratory stock preparation and aliquoting. It is not a dosing protocol, makes no therapeutic claim, and the compound is not for human or veterinary use.