How to Reconstitute IGF-1 LR3
Research Stock Preparation Calculator
IGF-1 LR3 is supplied as a 1mg/vial vial for research use only. Its molecular weight is 9117.50 g/mol (C400H625N111O115S9). Primary sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMY CAPLKPAKSA. The steps below cover reconstitution and stock-concentration calculation for laboratory aliquoting. This page is not dosing guidance; the compound is not for human or veterinary use.
Reconstitution calculator
Enter the amount of compound in the vial and the solvent volume you plan to add to obtain the working concentration for research aliquoting.
Advanced: Net Peptide Content (NPC)
Peptide content factor accounts for counter-ions (TFA/acetate) and bound water. If unknown, an amino-acid analysis (AAA) on the certificate gives the real figure; TFA salts of small peptides commonly sit near 70–85%.
Reconstitution guide
Reconstituir con ácido acético 0,1 M.
Solubilidad
Soluble en ácido acético 0,1 M a 0,1 mg/mL
Storage & stability
Conservar a -20°C, proteger de la luz
Shelf life: 24 meses desde la fecha de fabricación.
Appearance & purity
Appearance: Polvo liofilizado blanco.
Purity: ≥99% (HPLC).
Datos de referencia
Research Use Only. This information supports laboratory stock preparation and aliquoting. It is not a dosing protocol, makes no therapeutic claim, and the compound is not for human or veterinary use.
